OmniRayn · Foundry Classroom · Web-Lab

Web-Lab
Peptide Training

Your class runs a complete peptide discovery workflow — entirely in the browser.

Instructors Students · web-lab
01
OmniRayn/Web-Lab Peptide Training
InstructorsStudents
The shift

Same discovery questions. New address.

The traditional lab

Synthesize. Run the assay. Wait for the result. Real data — but weeks of setup, thousands of dollars in reagents, and equipment most programs never touch.

The barrier

Students learn the vocabulary of discovery without running its steps. The evidence ladder is something they read about, not something they climb.

The web-lab

Free, browser-accessible tools — sequence retrieval, structure prediction, function annotation, experimental cross-reference — run with the same rigor, same documentation, same honesty requirements.

02
OmniRayn/Web-Lab Peptide Training
InstructorsStudents
The teaching candidate

GLP-1 — a 30-residue peptide. Fully public. Experimentally anchored.

Why it's safe to teach

Public reference standard. UniProt P01275 (proglucagon). GLP-1(7–36) amide — the active 30-residue fragment. No IP constraints. Decades of published structure data — a teaching specimen with a known answer to calibrate against.

The sequence (7–36 amide)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

30 residues. Compact enough for AlphaFold DB lookup in seconds. Highlighted: N-terminal activation residues (Phe12/Thr13/Asp15) + C-terminal ECD-contact helix (Glu27–Leu32).

The pedagogical opening

Receptor-binding residues are marked in the published literature. Students predict them computationally — then check against the experimental record. A real structure-function calibration exercise.

03
OmniRayn/Web-Lab Peptide Training
InstructorsStudents
The web-lab toolkit

Four browser tools. One discovery workflow.

Step 1
UniProt
Retrieve the FASTA sequence, known annotations, and flagged functional features.
Step 2
AlphaFold DB
Look up the pre-computed structure for P01275. Download the PDB. Read the per-residue pLDDT confidence score. No account required.
Step 3
ProteInfer
Annotate predicted function from sequence alone — Gene Ontology terms, confidence-scored.
Step 4
RCSB PDB
Pull the deposited experimental structure. Compare to your prediction. Calibrate your confidence.
All four are free, browser-accessible, and require no installation or account for basic use.
04
OmniRayn/Web-Lab Peptide Training
InstructorsStudents
The workflow

Sequence → Structure → Function → Mechanism.

Sequence

Pull the FASTA from UniProt (P01275). Identify the active fragment — residues 98–127. Note what the annotation flags as functionally significant before you predict anything.

Structure

Look up P01275 at the AlphaFold Protein Structure Database (alphafold.ebi.ac.uk). Download the PDB and examine the pLDDT score per residue. Which regions does the model trust — and which doesn't it?

Function

Run the sequence through ProteInfer. Read the GO-term predictions and their confidence scores. This is function prediction from sequence alone — not function confirmation.

Mechanism hypothesis

Pull the RCSB PDB deposited structure. Compare to your AlphaFold prediction. Where do they agree? Where do they diverge? Document the divergence — that's the finding, not the failure.

05
OmniRayn/Web-Lab Peptide Training
InstructorsStudents
Reading the output

A high pLDDT score is not a truth claim.

Very high (> 90) Confident (70–90) Low (50–70) Very low (< 50)
pLDDT > 90 — Very high

Model is confident in the local backbone geometry. Well-structured region. Good starting point for receptor-binding hypotheses. Still computational — pending wet-lab corroboration.

pLDDT 70–90 — Confident

Generally correct backbone, some loop flexibility. Useful for structure-function reasoning — with explicit hedging. Annotate as "predicted, moderate confidence."

pLDDT 50–70 — Low

Disordered or flexible region. May be functionally significant — intrinsically disordered regions often mediate binding. Annotate, don't ignore.

pLDDT < 50 — Very low

Don't build function hypotheses here. Flag as unresolved. The correct move is to document the uncertainty, not to paper over it.

06
OmniRayn/Web-Lab Peptide Training
Before you run
Pre-register your output

Define what counts as a credible characterization before you open the tool.

≥ 70 avg pLDDT

Average across the active fragment must clear 70. Below this, the prediction is too uncertain to anchor function hypotheses.

≥ 1 GO annotation ≥ 0.5

ProteInfer returns at least one Gene Ontology term with confidence above 0.5 — a predicted function, not just sequence homology.

Full provenance documented

Tool, version, date, parameters. A prediction without provenance is opinion. Provenance makes it reproducible — and that distinction is the lesson.

07
OmniRayn/Web-Lab Peptide Training
InstructorsStudents
What students walk away with

Computational fluency. A dossier entry. And the ability to read certainty.

Computational skills

FASTA retrieval, structure prediction, pLDDT interpretation, experimental cross-reference — the same workflow a working discovery pipeline runs, executed by the student.

A dossier entry

A provenanced computational characterization of a real peptide — authored by the student, confidence-labeled per the OmniRayn Foundry tier system.

Confidence-tier fluency

The ability to distinguish what a computation says from what it means — and to label the gap between them honestly. A skill that transfers to every paper they'll ever read.

08
OmniRayn/Web-Lab Peptide Training
Non-commercial
The license

"Computational predictions, pending wet-lab; structure-function framing only; not experimental evidence and not a disease, treatment, or efficacy claim."

Free for accredited institutions, non-commercial use. Commercial use, substantiation, or spin-out escalates to the commercial Data License.

09